LLMs in Biology Applications
As we saw in the previous section, Large Language Models (LLMs) have demonstrated remarkable capabilities in summarizing, processing, and generating human-like text. Their success hinges on the assumption that natural language can be modeled as a system of sequential words/sounds (tokens), and that the precise arrangement of those tokens is what gives rise to context and meaning.
If we look elsewhere in nature, we find it is rich with sequential information and processes - DNA sequences, transcriptomes, protein sequences, signal transduction cascades, metabolic pathways, and even small molecules (interpreted as SMILES strings). Do these sequences in nature have their own “vocabulary” conferring some biological importance? If we treat these sequences as language, can we uncover hidden signals or patterns with LLMs?
In this section, we will look at how LLMs are currently being used in a few different areas in the life sciences. The hands-on examples are driven by current topics found in the literature. By the end of this section, you should be able to:
Pull existing models from Hugging Face using the
transformerslibraryApply DNABERT-2 to a DNA sequence classification task
Generate new protein sequences using ProtGPT2
Note
The following examples should be done in a Jupyter Notebook on Vista with the Day4-pt-251
kernel. If you are doing this elsewhere, you need to install a few libraries:
$ pip install --user transformers scikit-learn pandas einops peft
Example 1: DNA Sequence Classification
DNABERT-2 is an advanced transformer-based foundation model designed for analyzing DNA sequences across multiple species. It builds upon the original DNABERT model by introducing significant improvements in tokenization and architecture, and it is trained on genomes from 135 different species. This allows DNABERT-2 to perform well on a wide range of genomic tasks, including promoter prediction, gene expression analysis, DNA methylation detection, and more.
Given DNA sequences and labels, how would we approach a classification task?
How it Works
DNABERT and DNABERT-2 are transformer-based architectures modeled after Google’s BERT architecture. BERT (Bidirectional Encoder Representations from Transformers) deviates from the traditional transformer architecture in that it only uses the encoder portion of the original model. Traditional transformers include both an encoder and decoder for sequence-to-sequence tasks like translation, but BERT-like models are designed solely for understanding language, not generating it.
The original DNABERT tokenized k-mer sequences with fixed length as input, and added a CLS token (a tag representing meaning of entire sentence), a SEP token (sentence separator) and MASK tokens (to represent masked k-mers in pre-training). The input is embedded and fed through 12 transformer blocks. The outputs can be interepreted for sentence-level classification or token-level classification.
The original DNABERT model [1] (shown above) was improved in DNABERT-2 [2]
Some of the key innovations of DNABERT-2 over the original DNABERT include:
Byte Pair Encoding (BPE) Tokenization: Instead of fixed-length k-mer tokenization, which can be computationally inefficient and may not capture variable-length patterns effectively. DNABERT-2 replaces this with BPE, a data-driven compression algorithm that identifies and merges frequently occurring nucleotide sequences. This approach reduces sequence length by approximately five times on average, enhancing computational efficiency and preserving meaningful biological patterns.
Enhanced Model Architecture: DNABERT-2 improves upon the original model by replacing the original embeddings with Attention with Linear Biases (ALiBi) embeddings, which overcome limitations with input length and allow the model to handle inputs of unlimited length without performance issues. Also, DNABERT-2 incorporates Flash Attention, an optimized mechanism for improved IO to accelerate training and inference and reducing memory requirements.
Genome Understanding Evaluation (GUE) Benchmark: The original DNABERT was trained on human sequences alone. DNABERT-2 is trained on genomes from 135 different species, enhancing its generalizability across diverse organisms. To assess and compare genome models effectively, the developers introduced the GUE benchmark, a massive amalgam of 36 datasets for 9 different genomic tasks.
DNABERT-2 is trained and evaluated on massive amounts of data:
Trained on genomes from 135 species comprising >32B bases
Evaluated with the GUE benchmark for 9 different genome classification tasks
In total, there were 262B training tokens and 117M parameters in the model
With these improvements, DNABERT-2 was able to outperform its predecessor on 23 out of 28 datasets from the GUE benchmark in tasks like promoter prediction, gene expression analysis, DNA methylation detection, chromatin state classification, and variant effect prediction.
Try it Out
Let’s perform a simple classification task using DNABERT-2. First, use the transformers.pipeline
method to load the 117M parameter model from
Hugging Face:
>>> import torch
>>> from transformers import AutoTokenizer, AutoModel
>>> tokenizer = AutoTokenizer.from_pretrained('zhihan1996/DNABERT-2-117M', trust_remote_code=True)
>>> model = AutoModel.from_pretrained('zhihan1996/DNABERT-2-117M', trust_remote_code=True)
Then, try tokenizing a sample DNA sequence using the tokenizer provided by the authors. This fragments the sequence into variable length k-mers and assigns each k-mer a unique token ID:
>>> dna = 'ACGTAGCATCGGATCTATCTATCGACACTTGGTTATCGATCTACGAGCATCTCGTTAGC' # sample sequence
>>> inputs = tokenizer(dna, return_tensors='pt')['input_ids']
>>> print(type(inputs))
>>> print(inputs.shape)
>>> print(inputs)
<class 'torch.Tensor'>
torch.Size([1, 17])
tensor([[ 1, 5, 194, 32, 757, 1239, 2092, 294, 24, 359, 88, 93,
32, 75, 77, 19, 2]])
The tokenizer gives you back a tensor (in this case, a vector) of token IDs. With DNABERT-2, the
first token (1) and last token (2) are always the same - the CLS and SEP tokens. The rest of
the sequence is broken down and given an encoded ID from a look up table.
Can we see how the sequence was tokenized? Yes! Let’s do a little reverse engineering to see how the author’s tokenizer broke down the sequence into k-mers:
>>> token_ids = inputs[0].tolist()
>>> tokens = tokenizer.convert_ids_to_tokens(token_ids)
>>> print(tokens)
['[CLS]', 'A', 'CGTA', 'GCA', 'TCGGA', 'TCTATCTA', 'TCGACA', 'CTTGG', 'TTA', 'TCGA', 'TCTA', 'CGA', 'GCA', 'TCTC', 'GTTA', 'GC', '[SEP]']
What are some general observations you can make about the tokenization?
Lets now turn our attention to the model. To see details of the model architecture, you can inspect
the model object that we created above:
>>> print(model)
Click below to expand the model architecture - notice anything familiar?
BertModel(
(embeddings): BertEmbeddings(
(word_embeddings): Embedding(4096, 768)
(token_type_embeddings): Embedding(2, 768)
(LayerNorm): LayerNorm((768,), eps=1e-12, elementwise_affine=True)
(dropout): Dropout(p=0.1, inplace=False)
)
(encoder): BertEncoder(
(layer): ModuleList(
(0-11): 12 x BertLayer(
(attention): BertUnpadAttention(
(self): BertUnpadSelfAttention(
(dropout): Dropout(p=0.0, inplace=False)
(Wqkv): Linear(in_features=768, out_features=2304, bias=True)
)
(output): BertSelfOutput(
(dense): Linear(in_features=768, out_features=768, bias=True)
(LayerNorm): LayerNorm((768,), eps=1e-12, elementwise_affine=True)
(dropout): Dropout(p=0.1, inplace=False)
)
)
(mlp): BertGatedLinearUnitMLP(
(gated_layers): Linear(in_features=768, out_features=6144, bias=False)
(act): GELU(approximate='none')
(wo): Linear(in_features=3072, out_features=768, bias=True)
(dropout): Dropout(p=0.1, inplace=False)
(layernorm): LayerNorm((768,), eps=1e-12, elementwise_affine=True)
)
)
)
)
(pooler): BertPooler(
(dense): Linear(in_features=768, out_features=768, bias=True)
(activation): Tanh()
)
)
This pre-trained model by itself does not have broad utility. We need to fine tune the model to a specific task (e.g. classification). For this example, we will fine tune it to build a classifier to predict whether a sequence is from a coding region of DNA or not.
We have previously downloaded and modified a DNA sequence dataset from Kaggle. The adapted dataset contains two columns: the sequence and a label (1=coding, 0=non-coding). The dataset is in CSV format and can be downloaded directly from this URL. Since the data is available on the web, it is easiest to use pandas to just read it in directly.
>>> import pandas as pd
>>> data = pd.read_csv('https://raw.githubusercontent.com/TACC/life_sciences_ml_at_tacc/refs/heads/main/docs/section5/files/Coding_NonCoding_DNA_Sequences.csv')
>>> print(data.shape)
>>> print(data.head())
(65321, 2)
DNA_sequence Target
0 CTCTTGCGGTCGATCTGGTCACGGGTGATGGTGAAGGTTACGTAGT... 1
1 TCGCGGTCCCGAGCCTGATCGTGCGCCGCGCCAACACGACGGTCGA... 1
2 GGCTACGACGTGACCGCGGGGCAGGTGCTCGTGACCAACGGCGGCA... 1
3 CAGGTAGGTGCCACAGTAGTAAGCGGTGATGCAGTTGCCCCTGAAT... 1
4 GAGTTGTCCTGGTAAGATTCTTACCCATGCGAATCACGTCGAAAGG... 1
It appears there are 65,321 rows and 2 columns. How many of each class are included in the dataset?
>>> data['Target'].value_counts()
Target
0 45603
1 19718
Name: count, dtype: int64
It’s about 70% non-coding and 30% coding DNA. This is a fairly large data set - more data generally is better for training a model. However to save time in this workshop, let’s subsample it to just 1000 sequences, checking to make sure that it preserves the ratio:
>>> data_subset = data.sample(1000)
>>> print(data_subset['Target'].value_counts())
Target
0 694
1 306
Name: count, dtype: int64
That’s pretty close - we have narrowed it down to 1000 sequences, 694 of which are from non-coding regions of DNA, and 306 of which are from coding regions.
Next, let’s use the tokenizer that we pulled from Hugging Face to slice up those 1000 sequences into short k-mers (of variable length), then encode them into a tensor of token IDs.
>>> data_subset_list = data_subset.DNA_sequence.values.tolist()
>>> inputs = tokenizer(data_subset_list, return_tensors="pt", padding=True)["input_ids"]
Then, use the model that we pulled from Hugging Face to get the embeddings, given the token IDs. The embeddings are a mathematical representation of the hidden states of the model.
Warning
This step may take about 3 or 4 minutes for 1000 sequences.
>>> embeddings = model(inputs)
>>> embedding_data = torch.mean(embeddings[0], dim=1).detach().numpy()
Given those embeddings and the known labels (coding or non-coding), we can train a simple classifier to predict the labels of unknown DNA sequences. For this example, we can use a Naive Bayes Classifier, which typically works well with high-dimension data. As we have seen before, we split our embeddings (which we treat as features) and labels into train and test sets. Then, we fit the classifer to the training set and predict the labels of our test set.
>>> from sklearn.naive_bayes import GaussianNB
>>> from sklearn.model_selection import train_test_split
>>> X_train, X_test, y_train, y_test = train_test_split(embedding_data, data_subset.Target, test_size=0.3, stratify=data_subset.Target, random_state=1)
>>> gnb = GaussianNB()
>>> y_pred = gnb.fit(X_train, y_train).predict(X_test)
How did we do?
>>> from sklearn.metrics import classification_report
>>> print(f"Performance on TEST\n*******************\n{classification_report(y_test, gnb.predict(X_test))}")
>>> print(f"Performance on TRAIN\n********************\n{classification_report(y_train, gnb.predict(X_train))}")
Performance on TEST
*******************
precision recall f1-score support
0 0.83 0.69 0.76 214
1 0.46 0.65 0.54 86
accuracy 0.68 300
macro avg 0.65 0.67 0.65 300
weighted avg 0.72 0.68 0.69 300
Performance on TRAIN
********************
precision recall f1-score support
0 0.86 0.71 0.78 500
1 0.49 0.71 0.58 200
accuracy 0.71 700
macro avg 0.68 0.71 0.68 700
weighted avg 0.76 0.71 0.72 700
Accuracy of 0.68 is not great - but this is using the embeddings alone as our features. Could we get a better outcome if we trained over all ~65K sequences? Can we get a better outcome if we fine tune the original DNABERT-2 model that was previously trained on 32B bases, and then use their baked-in sequence classifier?
Note
You can also give it just one sequence for classification. For example, give it the sequence from above:
>>> dna = 'ACGTAGCATCGGATCTATCTATCGACACTTGGTTATCGATCTACGAGCATCTCGTTAGC'
>>> dna_tokenized = tokenizer(dna, return_tensors='pt')['input_ids']
>>> dna_embedded = model(dna_tokenized)
>>> dna_embedded_data = torch.mean(dna_embedded[0], dim=1).detach().numpy()
>>> pred=gnb.predict(dna_embedded_data)
>>> print(pred)
[0]
Rather than trying to run all of the Python code required for this in the Jupyter notebook, a quick check of the author’s GitHub repo shows they wrote a convenient script to do exactly what we want to do - fine tune their model with our input sequences for a classification task.
In order to run their script, we just need to clone their GitHub repo, and prepare three input
files: train.csv, test.csv, and dev.csv (this last one is what they call their
validation set).
We can prepare those three files by sub-sampling our 1000-sequence subset:
>>> import os
>>> scratch = os.environ.get('SCRATCH')
>>> os.mkdir(f'{scratch}/sample_data_for_dnabert2')
>>> data_subset.iloc[:600].to_csv(f'{scratch}/sample_data_for_dnabert2/train.csv', index=False)
>>> data_subset.iloc[600:750].to_csv(f'{scratch}/sample_data_for_dnabert2/dev.csv', index=False)
>>> data_subset.iloc[750:].to_csv(f'{scratch}/sample_data_for_dnabert2/test.csv', index=False)
Does anyone see any potential problems with this approach?
Next, open up a terminal from Jypyter Lab and clone the DNABERT-2 GitHub repo:
[gh]$ cds # cd to SCRATCH
[gh]$ git clone https://github.com/MAGICS-LAB/DNABERT_2
[gh]$ cd DNABERT_2/finetune/
Then, run the training script. The container image was prepared previously by installing the dependencies listed in the author’s GitHub repo.
Warning
This step may take about 15 minutes for 5 epochs.
[gh]$ module load tacc-apptainer
[gh]$ export APPTAINER_CACHEDIR=$SCRATCH/apptainer_cache
[gh]$ apptainer exec docker://wjallen/dnabert2:1.0 \
python train.py \
--model_name_or_path zhihan1996/DNABERT-2-117M \
--data_path ${SCRATCH}/sample_data_for_dnabert2/\
--kmer -1 \
--run_name DNABERT2_test \
--model_max_length 100 \
--per_device_train_batch_size 8 \
--per_device_eval_batch_size 16 \
--gradient_accumulation_steps 1 \
--learning_rate 3e-5 \
--num_train_epochs 5 \
--fp16 \
--save_steps 200 \
--output_dir output/ \
--evaluation_strategy steps \
--eval_steps 200 \
--warmup_steps 50 \
--logging_steps 100 \
--overwrite_output_dir True \
--log_level info \
--find_unused_parameters False
What is learning_rate? Is it set to a small number or a big number here? Why is it set the way it is? Any other notable parameters?
If successful, the script outputs the results to the output/ directory, which you can check as
follows:
[gh]$ cat output/results/DNABERT2_test/eval_results.json
{"eval_loss": 0.5799916386604309,
"eval_accuracy": 0.696,
"eval_f1": 0.5968084203378321,
"eval_matthews_correlation": 0.2162526926317811,
"eval_precision": 0.6257488069854807,
"eval_recall": 0.5929735004879513,
"eval_runtime": 24.8139,
"eval_samples_per_second": 10.075,
"eval_steps_per_second": 0.645,
"epoch": 5.0 }
Slightly better than the Naive Bayes classifier we trained above, but not by much. Congratulations! You’ve successfully completed a simple classification task using DNABERT-2.
Other Notable DNA Sequence Models
Example 2: Protein Design
ProtGPT2 is a specialized LLM trained by transfer learning of protein sequence information on top of GPT-2. It is designed to generate novel protein sequences following biological principles of naturally-occurring proteins. Sequences generated by ProtGPT2 have typical amino acid compositions, generally are predicted to be globular, and sequence searches show they are distantly related to real proteins, yet they exist in a new and unexplored protein space.
How it Works
ProtGPT2 works by leveraging a GPT-2-like transformer architecture. GPT-2 (Generative Pretrained Transformer 2) also deviates from the traditional transformer, but this architecture only uses the decoder portion of the model. As mentioned above, the full transformer includes both an encoder and decoder for tasks like translation, but GPT-2-like models are designed for generative tasks such as text completion. It uses a unidirectional (left-to-right) attention mechanism, meaning each token pays attention (attention is all you need!) only to previous tokens, which enables text generation. This contrasts with bidirectional models like BERT, which use bidirectional attention for deeper
ProtGPT2 is trained specifically on protein sequence data. The model learns patterns, motifs, and structural features inherent in protein sequences by analyzing vast datasets of known proteins. This training enables ProtGPT2 to generate sequences that are not only syntactically valid but also biologically meaningful.
The process involves:
Tokenization: Protein sequences are broken down into smaller units (amino acid tokens) for processing
Training: The model is trained on large datasets of protein sequences to predict the next token in a sequence, capturing contextual relationships
Generation: Using the learned patterns, the model can generate new protein sequences by sampling from the probability distribution of possible tokens
Massive amounts of data go into the training and evaluation:
An autoregressive transformer model with 738 million parameters
Trained on ~50 million non-annotated protein sequences spanning all of known protein space
Generated and predicted structural and chemical properties for 10,000 new sequences
The authors report that by finetuning the model on a subset of sequences that a user chooses, the model can be biased toward certain end goals. For example:
Designing proteins with specific properties
Tune or alter biochemical functions of natural proteins
Exploring sequence space for novel enzymes or therapeutic proteins
Understanding sequence-function relationships
Try it Out
Use the transformers.pipeline method to load the protgpt2 model from
Hugging Face:
>>> from transformers import pipeline
>>> protgpt2 = pipeline('text-generation', model="nferruz/ProtGPT2")
config.json: 100% 850/850 [00:00<00:00, 164kB/s]
pytorch_model.bin: 100% 3.13G/3.13G [00:39<00:00, 76.7MB/s]
model.safetensors: 100% 3.13G/3.13G [00:29<00:00, 107MB/s]
vocab.json: 100% 655k/655k [00:00<00:00, 6.85MB/s]
merges.txt: 100% 314k/314k [00:00<00:00, 5.05MB/s]
tokenizer.json: 100% 1.07M/1.07M [00:00<00:00, 5.44MB/s]
special_tokens_map.json: 100% 357/357 [00:00<00:00, 71.7kB/s]
The model may take a few minutes to download from the web, but inference only takes a few seconds. Use the default parameters to generate 10 brand new protein sequences:
>>> sequences = protgpt2("<|endoftext|>", max_length=100, do_sample=True, top_k=950, repetition_penalty=1.2, num_return_sequences=10, eos_token_id=0)
A few of the important parameters:
"<|endoftext|>": the starting token, in this case interpreted as starting anew or the amino acid Mmax_length=100: sets the maximum token length returned where each token is around four amino acidsdo_sample=True: enables sampling instead of greedy decoding, meaning the model will not just take the next token with the highest likelihood, instead it will randomly sample from the probability distribution of likelytop_k=950: number of most probably next tokens that are considered for sampling at each steprepetition_penalty=1.2: applies a penalty for repeating tokensnum_return_sequences=10: specifies how many sequences to generateeos_token_id=0: generation ceases (end of sequence / EOS) if token 0 is produced
The returned sequences object is a simple list that contains the generated sequences. Because
the model samples a probability distribution, the sequences should be different every time:
>>> print(type(sequences))
>>> print(len(sequences))
>>> print(sequences[0])
<class 'list'>
10
{'generated_text': '<|endoftext|>\nMAHTRENQWTAMRTLWFRLACLALVVMAITSCEEEEDDTVTRQFADVTSTLPAGITTVQF\nSNAFAGSVTWMTGEATTGPDITIVITGTGFESVASDNSVILTIGDVVVDVIQWSGTEIKI\nSVPASAVASTAKLEIKNMNGLSLDLPAKIKAAFTSINGGSNPNPSGGTNNIIIAGGPFAN\nGYSNIGQFKVGAPATGDDYALIQGNFLENPETGLFYIQLRRAEDSGQTYDLYFSKDDGTN\nWNSPVNLSGTVSPS'}
Alternatively, seed the model with a starting sequence token that you want to build from. For example, you may provide an N-termninal sequence or motif for a certain class of proteins (membrane bound, RNA-binding, etc.) and the model should generate other sequences with similar behavior.
>>> sequences = protgpt2("<|endoftext|>\nMKTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFPDWQNY", max_length=100, do_sample=True, top_k=950, repetition_penalty=1.2, num_return_sequences=1, eos_token_id=0)
>>> print(sequences[0]['generated_text'])
<|endoftext|>
MKTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFPDWQNYYLEHLNFMLQDLHPGSSL
PLILEIGCGSGEFLNYLAQKHQVLGVDINPDEIELAKHINPDANFLVAQAEALPFHKNTF
DYVLCMEVIEHLPNPELLINECKRVLKPNGTLLFTTPNFQSLQNRIKLLLGRSPKSQYYG
QEQFGHVNFFEVSSIKEIVKRFGLKPVKQKTFFPYIPSLSILHFIMNVFPIGYKFFCYLY
FRKEED
Congratulations! You’ve likely generated realistic protein sequences that no one has ever seen before. Perhaps think about plugging them in to Alphafold3 to model the structure.
Other Notable Protein Sequence Models
ProteinBERT - Prediction of protein-protein interactions
ESMFold - Protein folding mechanisms and interactions
ProGen - Generate novel protein sequences given natural language prompts